PRAMEF2 Peptide - C-terminal region
PRAMEF2 Peptide - C-terminal region
Product Specifications
Product Name Alternative
DJ845O24.3, RP5-845O24.1
UniProt
O60811
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PRAMEF2 Rabbit Polyclonal Antibody (orb587847) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_075390
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VRVNWEIFTPLRAELMCTLREFRQPKRIFIGPTPCPSCGSSPSEELELHL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS2062930-01 0.1 mL
HRP-Linked Polyclonal Antibody to Laminin Gamma 2 (LAMC2)
Sign In for Pricing
View Details MBS2062930-02 0.2 mL
HRP-Linked Polyclonal Antibody to Laminin Gamma 2 (LAMC2)
Sign In for Pricing
View Details MBS2062930-03 0.5 mL
HRP-Linked Polyclonal Antibody to Laminin Gamma 2 (LAMC2)
Sign In for Pricing
View Details MBS2062930-04 1 mL
HRP-Linked Polyclonal Antibody to Laminin Gamma 2 (LAMC2)
Sign In for Pricing
View Details MBS2062930-05 5 mL
HRP-Linked Polyclonal Antibody to Laminin Gamma 2 (LAMC2)
Sign In for Pricing
View Details