Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF286A Peptide - N-terminal region

ZNF286A Peptide - N-terminal region

Product Specifications

UniProt

A1A525

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF286A Rabbit Polyclonal Antibody (orb587855) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KSNLMKKQRTYKEKKPHKCNDCGELFTYHSVLIRHQRVHTGEKPYTCNEC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LONP2 Antibody
OAAJ11827-100UL 100 µL

LONP2 Antibody

Sign In for Pricing
View Details
ELISA Kit For Disintegrin and metalloproteinase domain-containing protein 12
E14640h 96 Tests

ELISA Kit For Disintegrin and metalloproteinase domain-containing protein 12

Sign In for Pricing
View Details
Ddah1 siRNA Oligos set (Rat)
17768176 3x 5 nmol

Ddah1 siRNA Oligos set (Rat)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Activating Transcription Factor 7 (ATF7)
MBS2054747-01 0.1 mL

PE-Linked Polyclonal Antibody to Activating Transcription Factor 7 (ATF7)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Activating Transcription Factor 7 (ATF7)
MBS2054747-02 0.2 mL

PE-Linked Polyclonal Antibody to Activating Transcription Factor 7 (ATF7)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Activating Transcription Factor 7 (ATF7)
MBS2054747-03 0.5 mL

PE-Linked Polyclonal Antibody to Activating Transcription Factor 7 (ATF7)

Sign In for Pricing
View Details