Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF286A Peptide - N-terminal region

ZNF286A Peptide - N-terminal region

Product Specifications

UniProt

A1A525

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF286A Rabbit Polyclonal Antibody (orb587855) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KSNLMKKQRTYKEKKPHKCNDCGELFTYHSVLIRHQRVHTGEKPYTCNEC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSP90 Antibody (HRP)
orb147315 200 µg

HSP90 Antibody (HRP)

Sign In for Pricing
View Details
IDO-2, Human (P.pastoris, His)
HY-P71743 1 Each

IDO-2, Human (P.pastoris, His)

Sign In for Pricing
View Details
Anti-CD90/Thy1 Antibody Picoband® Fluoro647 Conjugated
A01818-1-Fluoro647 100 µg/Vial

Anti-CD90/Thy1 Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
Mouse Monoclonal USP53 Antibody (OTI3C9) [DyLight 680]
NBP2-74812FR 0.1 mL

Mouse Monoclonal USP53 Antibody (OTI3C9) [DyLight 680]

Sign In for Pricing
View Details
NFKB1 Rabbit Polyclonal Antibody
AP20731PU-N 100 µg

NFKB1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Prepro-Chromogranin A (322-339) (Human)
053-14 100 µg

Prepro-Chromogranin A (322-339) (Human)

Sign In for Pricing
View Details