Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZCCHC18 Peptide - C-terminal region

ZCCHC18 Peptide - C-terminal region

Product Specifications

Product Name Alternative

PNMA7B, SIZN2

UniProt

P0CG32

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZCCHC18 Rabbit Polyclonal Antibody (orb587856) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001137450

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SGGSGYKNDGPGNIRRARKRKYTTRCSYCGEEGHSKETCDNESNKAQVFE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Fruit fly Tea Antibody Fluoro647 Conjugated
DZ41489-Fluoro647 200 µL/Vial

Anti-Fruit fly Tea Antibody Fluoro647 Conjugated

Sign In for Pricing
View Details
ELP3, NT (Elongator Complex Protein 3, EC 2.3.1.48, hELP3) (MaxLight 405)
MBS6473755-01 0.1 mL

ELP3, NT (Elongator Complex Protein 3, EC 2.3.1.48, hELP3) (MaxLight 405)

Sign In for Pricing
View Details
ELP3, NT (Elongator Complex Protein 3, EC 2.3.1.48, hELP3) (MaxLight 405)
MBS6473755-02 5x 0.1 mL

ELP3, NT (Elongator Complex Protein 3, EC 2.3.1.48, hELP3) (MaxLight 405)

Sign In for Pricing
View Details
ECM1 siRNA (Rat)
orb1830936-01 15 nmol

ECM1 siRNA (Rat)

Sign In for Pricing
View Details
ECM1 siRNA (Rat)
orb1830936-02 30 nmol

ECM1 siRNA (Rat)

Sign In for Pricing
View Details
Mouse Monoclonal NRIF3 Antibody (OTI4H1) [Biotin]
NBP2-73064B 0.1 mL

Mouse Monoclonal NRIF3 Antibody (OTI4H1) [Biotin]

Sign In for Pricing
View Details