Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZCCHC18 Peptide - C-terminal region

ZCCHC18 Peptide - C-terminal region

Product Specifications

Product Name Alternative

PNMA7B, SIZN2

UniProt

P0CG32

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZCCHC18 Rabbit Polyclonal Antibody (orb587856) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001137450

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SGGSGYKNDGPGNIRRARKRKYTTRCSYCGEEGHSKETCDNESNKAQVFE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti Candida mycoderma Glycerokinase, conjugated with Biotin
MBS573419-01 1 mL

Rabbit anti Candida mycoderma Glycerokinase, conjugated with Biotin

Sign In for Pricing
View Details
Rabbit anti Candida mycoderma Glycerokinase, conjugated with Biotin
MBS573419-02 5x 1 mL

Rabbit anti Candida mycoderma Glycerokinase, conjugated with Biotin

Sign In for Pricing
View Details
Rno-miR-542-5p miRNA Antagomir
CIS0201-01 10 nmol

Rno-miR-542-5p miRNA Antagomir

Sign In for Pricing
View Details
Rno-miR-542-5p miRNA Antagomir
CIS0201-02 20 nmol

Rno-miR-542-5p miRNA Antagomir

Sign In for Pricing
View Details
Mouse collagen, type I, alpha 1 (COL1A1) ELISA Kit
MBS7233902-01 48 Well

Mouse collagen, type I, alpha 1 (COL1A1) ELISA Kit

Sign In for Pricing
View Details
Mouse collagen, type I, alpha 1 (COL1A1) ELISA Kit
MBS7233902-02 96 Well

Mouse collagen, type I, alpha 1 (COL1A1) ELISA Kit

Sign In for Pricing
View Details