ZBTB8B Peptide - C-terminal region
ZBTB8B Peptide - C-terminal region
Product Specifications
Product Name Alternative
RP1-27O5.1, ZNF916B
UniProt
Q8NAP8
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ZBTB8B Rabbit Polyclonal Antibody (orb327182) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001139192
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LVEASSESQEKSDTDNDWPIYVESGEENDPAGDDSDDKPQIQPNLSDRET
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![CD45 (PTPRC) (CD45RA) Mouse Monoclonal Antibody [Clone ID: MB1]](https://cdn.genprice.uk/products/937/68dd189e061270361e8fd659/imageurl/am39020rp-n.webp)
AM39020RP-N 100 Tests
CD45 (PTPRC) (CD45RA) Mouse Monoclonal Antibody [Clone ID: MB1]
Sign In for Pricing
View Details ![Calreticulin (CALR) Mouse Monoclonal Antibody [Clone ID: OTI13H4]](https://cdn.genprice.uk/products/937/68dd18bb061270361e908efc/imageurl/cf813231.webp)
CF813231 100 µg
Calreticulin (CALR) Mouse Monoclonal Antibody [Clone ID: OTI13H4]
Sign In for Pricing
View Details 
AP53397PU-N 400 µL
BOB1 (POU2AF1) (N-term) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 
PDEH100820-01 20 µg
Recombinant Human Collagen α-1 (III) Chain/COL3A1 protein (His tag)
Sign In for Pricing
View Details PDEH100820-02 100 µg
Recombinant Human Collagen α-1 (III) Chain/COL3A1 protein (His tag)
Sign In for Pricing
View Details