Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZBTB8B Peptide - C-terminal region

ZBTB8B Peptide - C-terminal region

Product Specifications

Product Name Alternative

RP1-27O5.1, ZNF916B

UniProt

Q8NAP8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZBTB8B Rabbit Polyclonal Antibody (orb327182) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001139192

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LVEASSESQEKSDTDNDWPIYVESGEENDPAGDDSDDKPQIQPNLSDRET

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-Fluorodihydropyrimidine-2,4-dione
TRC-F591025-25MG 25 mg

5-Fluorodihydropyrimidine-2,4-dione

Sign In for Pricing
View Details
G CSF (CSF3) (NM_172220) Human Recombinant Protein
TP307709 20 µg

G CSF (CSF3) (NM_172220) Human Recombinant Protein

Sign In for Pricing
View Details
Tissue Total RNA, Bone: tibia, proximal
CR559741 5 µg

Tissue Total RNA, Bone: tibia, proximal

Sign In for Pricing
View Details
FRK Polyclonal Antibody
E-AB-15047-01 20 µL

FRK Polyclonal Antibody

Sign In for Pricing
View Details
FRK Polyclonal Antibody
E-AB-15047-02 60 µL

FRK Polyclonal Antibody

Sign In for Pricing
View Details
FRK Polyclonal Antibody
E-AB-15047-03 120 µL

FRK Polyclonal Antibody

Sign In for Pricing
View Details