DARS Peptide - C-terminal region
DARS Peptide - C-terminal region
Product Specifications
UniProt
P14868
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with DARS Rabbit Polyclonal Antibody (orb587935) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001340
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LAVRPFYTMPDPRNPKQSNSYDMFMRGEEILSGAQRIHDPQLLTERALHH
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1248297 Inquire
Recombinant Shewanella baltica Na (+)-translocating NADH-quinone reductase subunit D
Sign In for Pricing
View Details 
K3529804 1.0 µg DNA
Ap3m2 sgRNA CRISPR Lentivector (Mouse) (Target 3)
Sign In for Pricing
View Details MBS1004699 Inquire
Recombinant Desulfovibrio vulgaris Prolipoprotein diacylglyceryl transferase (lgt)
Sign In for Pricing
View Details 
LS026128-100ug 100 µg
KIAA1279 (KIF1BP) (NM_015634) Human Over-expression Lysate
Sign In for Pricing
View Details