Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNFAIP2 Peptide - N-terminal region

TNFAIP2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

B94, EXOC3L3

UniProt

Q03169

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TNFAIP2 Rabbit Polyclonal Antibody (orb587940) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006282

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EAAKKKKEKKKKSKGLANVFCVFTKGKKKKGQPSSAEPEDAAGSRQGLDG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COLGALT1 Polyclonal Antibody
E916571 100 µL

COLGALT1 Polyclonal Antibody

Sign In for Pricing
View Details
HIG2 Peptide
6491P 0.05 mg

HIG2 Peptide

Sign In for Pricing
View Details
Atp6v0e2 (NM_133764) Mouse Tagged Lenti ORF Clone
MR200146L4 10 µg

Atp6v0e2 (NM_133764) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
CYB5R3 Antibody, HRP conjugated
A38752-50UG 50 µg

CYB5R3 Antibody, HRP conjugated

Sign In for Pricing
View Details
Lentiviral human SUOX sgRNA gene knockout kit - Lentiviral human SUOX sgRNA gene knockout kit (100)
GTR15399964 1 Vial

Lentiviral human SUOX sgRNA gene knockout kit - Lentiviral human SUOX sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
Human OR8U1 knockdown cell line
ABC-KD10926 1 Vial

Human OR8U1 knockdown cell line

Sign In for Pricing
View Details