Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNFAIP2 Peptide - N-terminal region

TNFAIP2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

B94, EXOC3L3

UniProt

Q03169

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TNFAIP2 Rabbit Polyclonal Antibody (orb587940) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006282

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EAAKKKKEKKKKSKGLANVFCVFTKGKKKKGQPSSAEPEDAAGSRQGLDG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UNC5A 3'UTR Luciferase Stable Cell Line
TU027828 1.0 mL

UNC5A 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Human Protein FAM193A, C4orf8 ELISA Kit
MBS9325687-01 48 Well

Human Protein FAM193A, C4orf8 ELISA Kit

Sign In for Pricing
View Details
Human Protein FAM193A, C4orf8 ELISA Kit
MBS9325687-02 96 Well

Human Protein FAM193A, C4orf8 ELISA Kit

Sign In for Pricing
View Details
Human Protein FAM193A, C4orf8 ELISA Kit
MBS9325687-03 5x 96 Well

Human Protein FAM193A, C4orf8 ELISA Kit

Sign In for Pricing
View Details
Human Protein FAM193A, C4orf8 ELISA Kit
MBS9325687-04 10x 96 Well

Human Protein FAM193A, C4orf8 ELISA Kit

Sign In for Pricing
View Details
2,3,4-Trifluorophenol
290374-01 1 g

2,3,4-Trifluorophenol

Sign In for Pricing
View Details