Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GCM2 Peptide - N-terminal region

GCM2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

GCMB, hGCMb

UniProt

O75603

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GCM2 Rabbit Polyclonal Antibody (orb331413) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004743

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HSGYPVTNFWRLDGNAIFFQAKGVHDHPRPESKSETEARRSAIKRQMASF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IFITM5 Pre-designed siRNA Set B
SI007450B 1 Each

Human IFITM5 Pre-designed siRNA Set B

Sign In for Pricing
View Details
MRPL48 (Mitochondrial Ribosomal Protein L48, CGI-118, FLJ17047, FLJ99260, HSPC290, L48MT, MGC13323, MRP-L48)
248900 50 µL

MRPL48 (Mitochondrial Ribosomal Protein L48, CGI-118, FLJ17047, FLJ99260, HSPC290, L48MT, MGC13323, MRP-L48)

Sign In for Pricing
View Details
Lhfpl4 sgRNA CRISPR Lentivector (Rat) (Target 2)
K6255203 1.0 µg DNA

Lhfpl4 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Hsp20 (HSPB6) (NM_144617) Human Tagged ORF Clone Lentiviral Particle
RC209637L4V 200 µL

Hsp20 (HSPB6) (NM_144617) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
SNAPC4 Protein Lysate
OCOA13808-20UG 20 µg

SNAPC4 Protein Lysate

Sign In for Pricing
View Details
Ankrd46 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4740802 1.0 µg DNA

Ankrd46 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details