Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GCM2 Peptide - N-terminal region

GCM2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

GCMB, hGCMb

UniProt

O75603

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GCM2 Rabbit Polyclonal Antibody (orb331413) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004743

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HSGYPVTNFWRLDGNAIFFQAKGVHDHPRPESKSETEARRSAIKRQMASF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rcan2 (NM_175578) Rat Tagged Lenti ORF Clone
RR207596L3 10 µg

Rcan2 (NM_175578) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Misato (E-10) Alexa Fluor® 647
sc-390638 AF647 200 µg/mL

Misato (E-10) Alexa Fluor® 647

Sign In for Pricing
View Details
Rab10 sgRNA CRISPR Lentivector (Rat) (Target 1)
K6821302 1.0 µg DNA

Rab10 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
General PREG ELISA Kit
E109324 1 Each

General PREG ELISA Kit

Sign In for Pricing
View Details
Invadolysin (LmLN) (NM_033029) Human Untagged Clone
SC123908 10 µg

Invadolysin (LmLN) (NM_033029) Human Untagged Clone

Sign In for Pricing
View Details
MAP2ab Antibody
abx139731 0.1 mg

MAP2ab Antibody

Sign In for Pricing
View Details