CRYBB1 Peptide - middle region
CRYBB1 Peptide - middle region
Product Specifications
Product Name Alternative
CATCN3
UniProt
P53674
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CRYBB1 Rabbit Polyclonal Antibody (orb327195) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001878
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SIIVSAGPWVAFEQSNFRGEMFILEKGEYPRWNTWSSSYRSDRLMSFRPI
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15248226 1 Vial
Lentiviral mouse Grpel1 shRNA (UAS) - Lentiviral mouse Grpel1 shRNA (UAS) (100)
Sign In for Pricing
View Details 130079-APC 100 µL
MYO9B (Unconventional Myosin-IXb, Unconventional Myosin-9b, MYR5) APC discontinued
Sign In for Pricing
View Details MBS1393443-01 0.02 mg (E-Coli)
Recombinant Zea mays Protein BRICK1 (BRK1)
Sign In for Pricing
View Details MBS1393443-02 0.1 mg (E-Coli)
Recombinant Zea mays Protein BRICK1 (BRK1)
Sign In for Pricing
View Details