Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRYBB1 Peptide - middle region

CRYBB1 Peptide - middle region

Product Specifications

Product Name Alternative

CATCN3

UniProt

P53674

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CRYBB1 Rabbit Polyclonal Antibody (orb327195) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001878

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SIIVSAGPWVAFEQSNFRGEMFILEKGEYPRWNTWSSSYRSDRLMSFRPI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Erp27 shRNA (UAS) - Lentiviral mouse Erp27 shRNA (UAS, iRFP) plasmid
GTR15227452 1 Vial

Lentiviral mouse Erp27 shRNA (UAS) - Lentiviral mouse Erp27 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
CLTB (Clathrin Light Chain B, Lcb)
MBS641772-01 0.1 mL

CLTB (Clathrin Light Chain B, Lcb)

Sign In for Pricing
View Details
CLTB (Clathrin Light Chain B, Lcb)
MBS641772-02 5x 0.1 mL

CLTB (Clathrin Light Chain B, Lcb)

Sign In for Pricing
View Details
(1H-Indol-2-ylmethyl) amine ≥95% (NMR)
229232-01 250 mg

(1H-Indol-2-ylmethyl) amine ≥95% (NMR)

Sign In for Pricing
View Details
(1H-Indol-2-ylmethyl) amine ≥95% (NMR)
229232-02 1 g

(1H-Indol-2-ylmethyl) amine ≥95% (NMR)

Sign In for Pricing
View Details
(1H-Indol-2-ylmethyl) amine ≥95% (NMR)
229232-03 5 g

(1H-Indol-2-ylmethyl) amine ≥95% (NMR)

Sign In for Pricing
View Details