Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASMT Peptide - N-terminal region

ASMT Peptide - N-terminal region

Product Specifications

UniProt

P46597

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ASMT Rabbit Polyclonal Antibody (orb587952) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VRASAHGTELLLDICVSLKLLKVETRGGKAFYRNTELSSDYLTTVSPTSQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WBP2 (N-term) Rabbit Polyclonal Antibody
AP14578PU-N 400 µL

WBP2 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
UBQLN3 (N-term) Rabbit Polyclonal Antibody
AP12096PU-N 400 µL

UBQLN3 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human LIPH activation kit by CRISPRa
GA116364 1 Kit

Human LIPH activation kit by CRISPRa

Sign In for Pricing
View Details
MAPT / TAU pThr181 (177-187) Mouse Monoclonal Antibody [Clone ID: 9B4]
AM26413PU-L 500 µg

MAPT / TAU pThr181 (177-187) Mouse Monoclonal Antibody [Clone ID: 9B4]

Sign In for Pricing
View Details
Histone H4 (Ab-16) Antibody
8D0034-AAT 50 µg

Histone H4 (Ab-16) Antibody

Sign In for Pricing
View Details
ATF 4 (ATF4) Mouse Monoclonal Antibody [Clone ID: OTI5F5]
CF812802 100 µg

ATF 4 (ATF4) Mouse Monoclonal Antibody [Clone ID: OTI5F5]

Sign In for Pricing
View Details