Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NEU2 Peptide - N-terminal region

NEU2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

SIAL2

UniProt

Q9Y3R4

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NEU2 Rabbit Polyclonal Antibody (orb587953) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005374

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ANVTRLCQVTSTDHGRTWSSPRDLTDAAIGPAYREWSTFAVGPGHCLQLH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD83 Rabbit Polyclonal Antibody
TA374488 100 µL

CD83 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Mycobacterium Gilvum nuoD Protein (aa 1-451)
VAng-Yyj4250-500gEcoli 500 µg (E. coli)

Recombinant Mycobacterium Gilvum nuoD Protein (aa 1-451)

Sign In for Pricing
View Details
Dispensette S Digital 0.5- 5mL
DIS1668 1 Each

Dispensette S Digital 0.5- 5mL

Sign In for Pricing
View Details
Human N-acylneuraminate-9-phosphatase, NANP ELISA KIT
ELI-42529h 96 Tests

Human N-acylneuraminate-9-phosphatase, NANP ELISA KIT

Sign In for Pricing
View Details
Recombinant Microcystis aeruginosa Ribonuclease P protein component (rnpA)
MBS1137710-01 0.02 mg (E-Coli)

Recombinant Microcystis aeruginosa Ribonuclease P protein component (rnpA)

Sign In for Pricing
View Details
Recombinant Microcystis aeruginosa Ribonuclease P protein component (rnpA)
MBS1137710-02 0.1 mg (E-Coli)

Recombinant Microcystis aeruginosa Ribonuclease P protein component (rnpA)

Sign In for Pricing
View Details