Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SMARCD3 Peptide - C-terminal region

SMARCD3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

BAF60C, CRACD3, Rsc6p

UniProt

Q6STE5

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SMARCD3 Rabbit Polyclonal Antibody (orb587957) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003069

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QSRSAIVQALWQYVKTNRLQDSHDKEYINGDKYFQQIFDCPRLKFSEIPQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Isoleucyl tRNA Synthetase (IARS) Antibody
abx173206-01 100 µL

Isoleucyl tRNA Synthetase (IARS) Antibody

Sign In for Pricing
View Details
Isoleucyl tRNA Synthetase (IARS) Antibody
abx173206-02 200 µL

Isoleucyl tRNA Synthetase (IARS) Antibody

Sign In for Pricing
View Details
Isoleucyl tRNA Synthetase (IARS) Antibody
abx173206-03 1 mL

Isoleucyl tRNA Synthetase (IARS) Antibody

Sign In for Pricing
View Details
Rat Conserved oligomeric Golgi complex subunit 1 (COG1) ELISA kit
GTR10448355 96 Well

Rat Conserved oligomeric Golgi complex subunit 1 (COG1) ELISA kit

Sign In for Pricing
View Details
RSPH9 Antibody - middle region
ARP67276_P050-25UL 25 µL

RSPH9 Antibody - middle region

Sign In for Pricing
View Details
TALK-1 Double Nickase Plasmid (h2)
sc-406360-NIC-2 20 µg

TALK-1 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details