Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SMARCD3 Peptide - C-terminal region

SMARCD3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

BAF60C, CRACD3, Rsc6p

UniProt

Q6STE5

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SMARCD3 Rabbit Polyclonal Antibody (orb587957) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003069

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QSRSAIVQALWQYVKTNRLQDSHDKEYINGDKYFQQIFDCPRLKFSEIPQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

B30C-2250-569-GY Continuous Tapes for Printers
117950 1 Box (1 Roll x 1 Roll)

B30C-2250-569-GY Continuous Tapes for Printers

Sign In for Pricing
View Details
MYO1E Human Pre-designed siRNA Set A
HY-RS08941 1 Set

MYO1E Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
Recombinant Human NGAL/Lipocalin-2/LCN2 (C-6His, Human Cells)
CX98-50ug 50 µg

Recombinant Human NGAL/Lipocalin-2/LCN2 (C-6His, Human Cells)

Sign In for Pricing
View Details
PLEKHF2 protein (His tag)
80R-3701 100 ug

PLEKHF2 protein (His tag)

Sign In for Pricing
View Details
Mouse CASP8-associated protein 2 (CASP8AP2) ELISA Kit
MBS7235641-01 48 Well

Mouse CASP8-associated protein 2 (CASP8AP2) ELISA Kit

Sign In for Pricing
View Details
Mouse CASP8-associated protein 2 (CASP8AP2) ELISA Kit
MBS7235641-02 96 Well

Mouse CASP8-associated protein 2 (CASP8AP2) ELISA Kit

Sign In for Pricing
View Details