Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPTA1 Peptide - N-terminal region

SPTA1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

EL2, HPP, HS3, SPH3, SPTA

UniProt

P02549

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPTA1 Rabbit Polyclonal Antibody (orb327198) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003117

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DELSGWMNEKTAAINADELPTDVAGGEVLLDRHQQHKHEIDSYDDRFQSA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cardiac Troponin I Antibody
KC-6317-01 50 μL

Cardiac Troponin I Antibody

Sign In for Pricing
View Details
Cardiac Troponin I Antibody
KC-6317-02 100 µL

Cardiac Troponin I Antibody

Sign In for Pricing
View Details
Cardiac Troponin I Antibody
KC-6317-03 1 mL

Cardiac Troponin I Antibody

Sign In for Pricing
View Details
Myelin oligodendrocyte glycoprotein (MOG) Rabbit Polyclonal Antibody
TA361053 100 µL

Myelin oligodendrocyte glycoprotein (MOG) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human KCNRG activation kit by CRISPRa
GA117035 1 Kit

Human KCNRG activation kit by CRISPRa

Sign In for Pricing
View Details
STING (TMEM173) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2C8]
TA505020AM 100 µL

STING (TMEM173) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2C8]

Sign In for Pricing
View Details