Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZFP64 Peptide - C-terminal region

ZFP64 Peptide - C-terminal region

Product Specifications

UniProt

Q9NTW7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZFP64 Rabbit Polyclonal Antibody (orb587995) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SFHCDICDASFMREDSLRSHKRQHSEYSESKNSDVTVLQFQIDPSKQPAT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lrrc15-set siRNA/shRNA/RNAi Lentivector (Mouse)
27623094 4x 500 ng

Lrrc15-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
Epidermal Growth Factor, Recombinant, Rat (EGF) discontinued
E3410A 100 µg

Epidermal Growth Factor, Recombinant, Rat (EGF) discontinued

Sign In for Pricing
View Details
SIDT1 Protein Lysate (Rat) with C-HA Tag
43748036 100 µg

SIDT1 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
Anti-SIRT7 Antibody Picoband® Fluoro594 Conjugated
PB9358-Fluoro594 100 µg/Vial

Anti-SIRT7 Antibody Picoband® Fluoro594 Conjugated

Sign In for Pricing
View Details
4933432B09Rik shRNA Plasmid (m)
sc-140323-SH 20 µg

4933432B09Rik shRNA Plasmid (m)

Sign In for Pricing
View Details
FITC Linked Monoclonal Antibody to Endoglin (ENG)
MBS2132095-01 0.1 mL

FITC Linked Monoclonal Antibody to Endoglin (ENG)

Sign In for Pricing
View Details