Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZFP64 Peptide - C-terminal region

ZFP64 Peptide - C-terminal region

Product Specifications

UniProt

Q9NTW7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZFP64 Rabbit Polyclonal Antibody (orb587995) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SFHCDICDASFMREDSLRSHKRQHSEYSESKNSDVTVLQFQIDPSKQPAT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chloroguanabenz acetate
T212052-01 10 mg

Chloroguanabenz acetate

Sign In for Pricing
View Details
Chloroguanabenz acetate
T212052-02 50 mg

Chloroguanabenz acetate

Sign In for Pricing
View Details
Karyopherin α5 (H-4) Alexa Fluor® 647
sc-515870 AF647 200 µg/mL

Karyopherin α5 (H-4) Alexa Fluor® 647

Sign In for Pricing
View Details
NBPF14 (NM_015383) Human Untagged Clone
SC114635 10 µg

NBPF14 (NM_015383) Human Untagged Clone

Sign In for Pricing
View Details
Hepatitis C Virus Antibody (Human) ELISA Kit (OKCA00424)
OKCA00424 96 Well

Hepatitis C Virus Antibody (Human) ELISA Kit (OKCA00424)

Sign In for Pricing
View Details
Recombinant Human Mannan-binding lectin serine protease 2 (MASP2)
MBS1139577-01 0.02 mg (E-Coli)

Recombinant Human Mannan-binding lectin serine protease 2 (MASP2)

Sign In for Pricing
View Details