Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DYNC2LI1 Peptide - N-terminal region

DYNC2LI1 Peptide - N-terminal region

Product Specifications

UniProt

Q8TCX1

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DYNC2LI1 Rabbit Polyclonal Antibody (orb588007) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LDRDEPPKPTLALEYTYGRRAKGHNTPKDIAHFWELGGGTSLLDLISIPI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IKBKAP Protein Vector (Rat) (pPM-C-HA)
24795026 500 ng

IKBKAP Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Recombinant Human TAF1 Protein
E30P2037 20 µg

Recombinant Human TAF1 Protein

Sign In for Pricing
View Details
PLAA Recombinant Antibody, AbBy Fluor™ 594 Conjugated
bsm-62333R-BF594-01 20 µL

PLAA Recombinant Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
PLAA Recombinant Antibody, AbBy Fluor™ 594 Conjugated
bsm-62333R-BF594-02 100 µL

PLAA Recombinant Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
ZMAT3 Antibody
MBS5316014-01 0.1 mL

ZMAT3 Antibody

Sign In for Pricing
View Details
ZMAT3 Antibody
MBS5316014-02 5x 0.1 mL

ZMAT3 Antibody

Sign In for Pricing
View Details