Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DYNC2LI1 Peptide - N-terminal region

DYNC2LI1 Peptide - N-terminal region

Product Specifications

UniProt

Q8TCX1

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DYNC2LI1 Rabbit Polyclonal Antibody (orb588007) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LDRDEPPKPTLALEYTYGRRAKGHNTPKDIAHFWELGGGTSLLDLISIPI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Folh1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3941208 1.0 µg DNA

Folh1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
ANGPTL7 (Angiopoietin-like 7, AngX, CDT6, RP4-647M16.2, dJ647M16.1)
243338 100 µg

ANGPTL7 (Angiopoietin-like 7, AngX, CDT6, RP4-647M16.2, dJ647M16.1)

Sign In for Pricing
View Details
Mouse Monoclonal RanGAP1 Antibody (OTI1B4) [mFluor Violet 450 SE]
NBP2-73797MFV450 0.1 mL

Mouse Monoclonal RanGAP1 Antibody (OTI1B4) [mFluor Violet 450 SE]

Sign In for Pricing
View Details
LCK Antibody
MBS5311342-01 0.1 mg

LCK Antibody

Sign In for Pricing
View Details
LCK Antibody
MBS5311342-02 5x 0.1 mg

LCK Antibody

Sign In for Pricing
View Details
ADPRH (NM_001125) Human Recombinant Protein
PROTP54922 20 µg

ADPRH (NM_001125) Human Recombinant Protein

Sign In for Pricing
View Details