Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APOBEC3D Peptide - C-terminal region

APOBEC3D Peptide - C-terminal region

Product Specifications

Product Name Alternative

A3D, ARP6, APOBEC3E, APOBEC3DE

UniProt

Q6ICH2

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with APOBEC3D Rabbit Polyclonal Antibody (orb324527) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005261394.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CPECAGEVAEFLARHSNVNLTIFTARLCYFWDTDYQEGLCSLSQEGASVK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mafaa Antibody
orb859992 2 mg

Mafaa Antibody

Sign In for Pricing
View Details
Kcnmb4 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K7102005 3x 1.0 µg

Kcnmb4 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
(2-Sulfamoyl-ethyl) -carbamic acid benzyl ester
LFA02717-01 250 mg

(2-Sulfamoyl-ethyl) -carbamic acid benzyl ester

Sign In for Pricing
View Details
(2-Sulfamoyl-ethyl) -carbamic acid benzyl ester
LFA02717-02 2.5 g

(2-Sulfamoyl-ethyl) -carbamic acid benzyl ester

Sign In for Pricing
View Details
Multiplex Assay Kit for Interleukin 10 (IL10), etc. by FLIA (Flow Luminescence Immunoassay)
TRV-0025264 96 Tests

Multiplex Assay Kit for Interleukin 10 (IL10), etc. by FLIA (Flow Luminescence Immunoassay)

Sign In for Pricing
View Details
CCDC114 Rabbit Polyclonal Antibody (Cy5)
orb880996 100 µL

CCDC114 Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details