Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APOBEC3D Peptide - C-terminal region

APOBEC3D Peptide - C-terminal region

Product Specifications

Product Name Alternative

A3D, ARP6, APOBEC3E, APOBEC3DE

UniProt

Q6ICH2

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with APOBEC3D Rabbit Polyclonal Antibody (orb324527) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005261394.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CPECAGEVAEFLARHSNVNLTIFTARLCYFWDTDYQEGLCSLSQEGASVK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal ATF6 Antibody [mFluor Violet 610 SE]
NBP1-77251MFV610 0.1 mL

Rabbit Polyclonal ATF6 Antibody [mFluor Violet 610 SE]

Sign In for Pricing
View Details
FAM83E Rabbit Polyclonal Antibody
orb583414 100 µL

FAM83E Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Monoclonal Cytokeratin 8/18 Antibody (KRT8.18/6579R) [Janelia Fluor 525]
NBP3-14099JF525 0.1 mL

Rabbit Monoclonal Cytokeratin 8/18 Antibody (KRT8.18/6579R) [Janelia Fluor 525]

Sign In for Pricing
View Details
Fabric mantle for erlenmeyer flask 1500ml, 350W, 230V, CE
100A O927CE 1 Each

Fabric mantle for erlenmeyer flask 1500ml, 350W, 230V, CE

Sign In for Pricing
View Details
ADRA2 Rabbit Polyclonal Antibody (Cy3)
orb987355 100 µL

ADRA2 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
Fetuin, Fetal Bovine Serum
MBS5801173 Inquire

Fetuin, Fetal Bovine Serum

Sign In for Pricing
View Details