Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLEC2D Peptide - C-terminal region

CLEC2D Peptide - C-terminal region

Product Specifications

UniProt

Q9UHP7

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CLEC2D Rabbit Polyclonal Antibody (orb579185) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GQPWKWINGTEWTRQLVMKEDGANLYVAKVSQVPRMNPRPVMVSYPGSRR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CDCP1 Biotinylated Affinity Purified PAb
BAF2666 50 µg

Human CDCP1 Biotinylated Affinity Purified PAb

Sign In for Pricing
View Details
TNF ELISA Kit (Bovine)
OKEH03750-96W 96 Tests

TNF ELISA Kit (Bovine)

Sign In for Pricing
View Details
Mouse Clba1 Pre-designed siRNA Set B
SI102658B 1 Each

Mouse Clba1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
2,4,4-Trimethyl-2-pentanol
420342-01 50 mg

2,4,4-Trimethyl-2-pentanol

Sign In for Pricing
View Details
2,4,4-Trimethyl-2-pentanol
420342-02 100 mg

2,4,4-Trimethyl-2-pentanol

Sign In for Pricing
View Details
PLD4 Antibody
MBS9510026-01 0.05 mL

PLD4 Antibody

Sign In for Pricing
View Details