Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF528 Peptide - middle region

ZNF528 Peptide - middle region

Product Specifications

UniProt

Q3MIS6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF528 Rabbit Polyclonal Antibody (orb325351) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LIRHRKTHTDEKPYKCNKCGTAFREFSDLTAHFLIHSGEKPYECKECGKV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gatsl3 AAV siRNA Pooled Vector
21341166 1.0 µg

Gatsl3 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Lithium Chloride 99% ACS
GPC6645-Y 1 Kg

Lithium Chloride 99% ACS

Sign In for Pricing
View Details
Rabbit Monoclonal CD2 Antibody (LFA2/8681R) [DyLight 405]
NBP3-24030V 0.1 mL

Rabbit Monoclonal CD2 Antibody (LFA2/8681R) [DyLight 405]

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Protein DYAD (DYAD) , partial
MBS1339897 Inquire

Recombinant Arabidopsis thaliana Protein DYAD (DYAD) , partial

Sign In for Pricing
View Details
Anti Prednisolone Pab Rabbit
165722 100 µg

Anti Prednisolone Pab Rabbit

Sign In for Pricing
View Details
Calpain 6/CAPN6 Rabbit Polyclonal Antibody
orb2657365 100 µg

Calpain 6/CAPN6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details