ZNF528 Peptide - middle region
ZNF528 Peptide - middle region
Product Specifications
UniProt
Q3MIS6
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ZNF528 Rabbit Polyclonal Antibody (orb325351) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LIRHRKTHTDEKPYKCNKCGTAFREFSDLTAHFLIHSGEKPYECKECGKV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Mouse Monoclonal NKp46/NCR1 Antibody (MM0491-8F24) [DyLight 405]](https://cdn.genprice.uk/genprice/uk/genprice2.webp)
NBP2-11820V 0.1 mL
Mouse Monoclonal NKp46/NCR1 Antibody (MM0491-8F24) [DyLight 405]
Sign In for Pricing
View Details 
MBS1057979-01 0.02 mg (E-Coli)
Recombinant Campylobacter jejuni subsp.jejuni serotype O:6 UPF0234 protein C8J_0350 (C8J_0350)
Sign In for Pricing
View Details MBS1057979-02 0.1 mg (E-Coli)
Recombinant Campylobacter jejuni subsp.jejuni serotype O:6 UPF0234 protein C8J_0350 (C8J_0350)
Sign In for Pricing
View Details MBS1057979-03 0.02 mg (Yeast)
Recombinant Campylobacter jejuni subsp.jejuni serotype O:6 UPF0234 protein C8J_0350 (C8J_0350)
Sign In for Pricing
View Details