Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ECI1 Peptide - C-terminal region

ECI1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DCI

UniProt

P42126

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ECI1 Rabbit Polyclonal Antibody (orb580446) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001171500.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QWMAIPDHARQLTKAMMRKATASRLVTQRDADVQNFVSFISKDSIQKSLQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glutathione Peroxidase 4 Antibody (Biotin)
KB-21259-01 50 μL

Glutathione Peroxidase 4 Antibody (Biotin)

Sign In for Pricing
View Details
Glutathione Peroxidase 4 Antibody (Biotin)
KB-21259-02 100 µL

Glutathione Peroxidase 4 Antibody (Biotin)

Sign In for Pricing
View Details
Glutathione Peroxidase 4 Antibody (Biotin)
KB-21259-03 1 mL

Glutathione Peroxidase 4 Antibody (Biotin)

Sign In for Pricing
View Details
Hippuric Acid-13C6
TRC-H356703-5MG 5 mg

Hippuric Acid-13C6

Sign In for Pricing
View Details
Tissue FFPE Sections, Thyroid gland
CS710991 5x 5 µm

Tissue FFPE Sections, Thyroid gland

Sign In for Pricing
View Details
MLH1 Recombinant Rabbit Monoclonal Antibody [SP08-04]
ET1604-41 100 µL

MLH1 Recombinant Rabbit Monoclonal Antibody [SP08-04]

Sign In for Pricing
View Details