Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ECI1 Peptide - C-terminal region

ECI1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DCI

UniProt

P42126

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ECI1 Rabbit Polyclonal Antibody (orb580446) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001171500.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QWMAIPDHARQLTKAMMRKATASRLVTQRDADVQNFVSFISKDSIQKSLQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MYO6 Antibody
KC-1383-01 50 μL

MYO6 Antibody

Sign In for Pricing
View Details
MYO6 Antibody
KC-1383-02 100 µL

MYO6 Antibody

Sign In for Pricing
View Details
MYO6 Antibody
KC-1383-03 1 mL

MYO6 Antibody

Sign In for Pricing
View Details
Cortisone ELISA Kit
K017-H1 1 Plate

Cortisone ELISA Kit

Sign In for Pricing
View Details
TMEM253 (NM_001146683) Human Over-expression Lysate
LY431176 100 µg

TMEM253 (NM_001146683) Human Over-expression Lysate

Sign In for Pricing
View Details
GABA A Receptor beta 3 (GABRB3) Goat Polyclonal Antibody
AP10064PU-N 100 µg

GABA A Receptor beta 3 (GABRB3) Goat Polyclonal Antibody

Sign In for Pricing
View Details