Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PITPNB Peptide - N-terminal region

PITPNB Peptide - N-terminal region

Product Specifications

UniProt

B7Z7Q0

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PITPNB Rabbit Polyclonal Antibody (orb585227) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EGIEVLKNEPYEKDGEKGQYTHKIYHLKSKVPAFVRMIAPEGSLVFHEKA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Arabidopsis thaliana G-type lectin S-receptor-like serine/threonine-protein kinase At1g11280 (At1g11280), partial
MBS1470311-01 0.5 mg (E-Coli)

Recombinant Arabidopsis thaliana G-type lectin S-receptor-like serine/threonine-protein kinase At1g11280 (At1g11280), partial

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana G-type lectin S-receptor-like serine/threonine-protein kinase At1g11280 (At1g11280), partial
MBS1470311-02 0.05 mg (Baculovirus)

Recombinant Arabidopsis thaliana G-type lectin S-receptor-like serine/threonine-protein kinase At1g11280 (At1g11280), partial

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana G-type lectin S-receptor-like serine/threonine-protein kinase At1g11280 (At1g11280), partial
MBS1470311-03 0.5 mg (Yeast)

Recombinant Arabidopsis thaliana G-type lectin S-receptor-like serine/threonine-protein kinase At1g11280 (At1g11280), partial

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana G-type lectin S-receptor-like serine/threonine-protein kinase At1g11280 (At1g11280), partial
MBS1470311-04 0.05 mg (Mammalian-Cell)

Recombinant Arabidopsis thaliana G-type lectin S-receptor-like serine/threonine-protein kinase At1g11280 (At1g11280), partial

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana G-type lectin S-receptor-like serine/threonine-protein kinase At1g11280 (At1g11280), partial
MBS1470311-05 1 mg (E-Coli)

Recombinant Arabidopsis thaliana G-type lectin S-receptor-like serine/threonine-protein kinase At1g11280 (At1g11280), partial

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana G-type lectin S-receptor-like serine/threonine-protein kinase At1g11280 (At1g11280), partial
MBS1470311-06 0.1 mg (Baculovirus)

Recombinant Arabidopsis thaliana G-type lectin S-receptor-like serine/threonine-protein kinase At1g11280 (At1g11280), partial

Sign In for Pricing
View Details