Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PITPNB Peptide - N-terminal region

PITPNB Peptide - N-terminal region

Product Specifications

UniProt

B7Z7Q0

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PITPNB Rabbit Polyclonal Antibody (orb585227) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EGIEVLKNEPYEKDGEKGQYTHKIYHLKSKVPAFVRMIAPEGSLVFHEKA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR51I1 sgRNA CRISPR Lentivector (Human) (Target 1)
K1564702 1.0 µg DNA

OR51I1 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Avatrombopag Impurity 153
RM-A220253-01 10 mg

Avatrombopag Impurity 153

Sign In for Pricing
View Details
Avatrombopag Impurity 153
RM-A220253-02 100 mg

Avatrombopag Impurity 153

Sign In for Pricing
View Details
Avatrombopag Impurity 153
RM-A220253-03 25 mg

Avatrombopag Impurity 153

Sign In for Pricing
View Details
Avatrombopag Impurity 153
RM-A220253-04 50 mg

Avatrombopag Impurity 153

Sign In for Pricing
View Details
IRX5 Double Nickase Plasmid (m2)
sc-424833-NIC-2 20 µg

IRX5 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details