SEC13 Peptide - C-terminal region
SEC13 Peptide - C-terminal region
Product Specifications
Product Name Alternative
D3S1231E, SEC13L1, SEC13R, npp-20
UniProt
P55735
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SEC13 Rabbit Polyclonal Antibody (orb585464) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_899195
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: IKLWKEEEDGQWKEEQKLEAHSDWVRDVAWAPSIGLPTSTIASCSQDGRV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![PE/Cyanine5.5 Mouse IgM, κ Isotype Control[MM-30]](https://cdn.genprice.uk/products/763/68dd14b2061270361e7d4061/imageurl/e-ab-f09782i.webp)
E-AB-F09782I-01 20 Tests
PE/Cyanine5.5 Mouse IgM, κ Isotype Control[MM-30]
Sign In for Pricing
View Details E-AB-F09782I-02 100 Tests
PE/Cyanine5.5 Mouse IgM, κ Isotype Control[MM-30]
Sign In for Pricing
View Details E-AB-F09782I-03 2x 100 Tests
PE/Cyanine5.5 Mouse IgM, κ Isotype Control[MM-30]
Sign In for Pricing
View Details 
AP08304PU-N 50 µg
Aquaporin 2 (AQP2) (N-term) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 