SEC13 Peptide - C-terminal region
SEC13 Peptide - C-terminal region
Product Specifications
Product Name Alternative
D3S1231E, SEC13L1, SEC13R, npp-20
UniProt
P55735
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SEC13 Rabbit Polyclonal Antibody (orb585464) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_899195
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: IKLWKEEEDGQWKEEQKLEAHSDWVRDVAWAPSIGLPTSTIASCSQDGRV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC882007-100 1x 100 µL
MHC II, Mouse (MK-D6), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
![Hexachlorobicyclo[2.2.1]hept-5-ene-2,3-dicarboxylic Acid](https://cdn.genprice.uk/products/572/9133221748480/imageurl/trc-h290768-2.5g.webp)
TRC-H290768-2.5G 2.5 g
Hexachlorobicyclo[2.2.1]hept-5-ene-2,3-dicarboxylic Acid
Sign In for Pricing
View Details 
