ARMCX5 Peptide - C-terminal region
ARMCX5 Peptide - C-terminal region
Product Specifications
UniProt
Q6P1M9
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ARMCX5 Rabbit Polyclonal Antibody (orb585546) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_073749
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: QFKTKAKLFTKEKFTKSELISIFQEAKQFGQKLQDLAEHSDPEVRDKVIR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![KCTD9 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4E9]](https://cdn.genprice.uk/products/937/6868c3d8994c49e6dc400575/imageurl/ta807666bm.webp)
TA807666BM 100 µL
KCTD9 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4E9]
Sign In for Pricing
View Details 
BNCB1018-100 1x 100 µL
CD117 (Cocktail), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
