ARMCX5 Peptide - C-terminal region
ARMCX5 Peptide - C-terminal region
Product Specifications
UniProt
Q6P1M9
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ARMCX5 Rabbit Polyclonal Antibody (orb585546) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_073749
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: QFKTKAKLFTKEKFTKSELISIFQEAKQFGQKLQDLAEHSDPEVRDKVIR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![OXSM Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1G5]](https://cdn.genprice.uk/products/937/6868c3a0994c49e6dc3fb6af/imageurl/ta802187am.webp)
TA802187AM 100 µL
OXSM Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1G5]
Sign In for Pricing
View Details 