Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DRG2 Peptide - N-terminal region

DRG2 Peptide - N-terminal region

Product Specifications

UniProt

P55039

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DRG2 Rabbit Polyclonal Antibody (orb586133) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001379

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MGILEKISEIEKEIARTQKNKATEYHLGLLKAKLAKYRAQLLEPSKSASS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SF3A1 AAV siRNA Pooled Vector
43562161 1.0 µg

SF3A1 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
2-hydroxy-3-{[ (2-methylpropanoyl) oxy]methyl}-4- (2-oxopropyl) benzoic acid
orb3171103-01 1 mg

2-hydroxy-3-{[ (2-methylpropanoyl) oxy]methyl}-4- (2-oxopropyl) benzoic acid

Sign In for Pricing
View Details
2-hydroxy-3-{[ (2-methylpropanoyl) oxy]methyl}-4- (2-oxopropyl) benzoic acid
orb3171103-02 2 mg

2-hydroxy-3-{[ (2-methylpropanoyl) oxy]methyl}-4- (2-oxopropyl) benzoic acid

Sign In for Pricing
View Details
2-hydroxy-3-{[ (2-methylpropanoyl) oxy]methyl}-4- (2-oxopropyl) benzoic acid
orb3171103-03 3 mg

2-hydroxy-3-{[ (2-methylpropanoyl) oxy]methyl}-4- (2-oxopropyl) benzoic acid

Sign In for Pricing
View Details
2-hydroxy-3-{[ (2-methylpropanoyl) oxy]methyl}-4- (2-oxopropyl) benzoic acid
orb3171103-04 4 mg

2-hydroxy-3-{[ (2-methylpropanoyl) oxy]methyl}-4- (2-oxopropyl) benzoic acid

Sign In for Pricing
View Details
2-hydroxy-3-{[ (2-methylpropanoyl) oxy]methyl}-4- (2-oxopropyl) benzoic acid
orb3171103-05 5 mg

2-hydroxy-3-{[ (2-methylpropanoyl) oxy]methyl}-4- (2-oxopropyl) benzoic acid

Sign In for Pricing
View Details