DCAF12L2 Peptide - C-terminal region
DCAF12L2 Peptide - C-terminal region
Product Specifications
Product Name Alternative
WDR40C
UniProt
Q5VW00
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with DCAF12L2 Rabbit Polyclonal Antibody (orb326751) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001013650
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LDPRQRQQNIRPLCSREGGTGVRSLSFYQHIITVGTGHGSLLFYDIRAQK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNCB0719-500 1x 500 µL
Mitochondrial Marker (MTC719), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
![IP3 receptor (ITPR1) Rabbit Monoclonal Antibody [Clone ID: R08-3P-1]](https://cdn.genprice.uk/products/937/6868c2ff994c49e6dc3ec186/imageurl/ta421945.webp)
TA421945 100 µL
IP3 receptor (ITPR1) Rabbit Monoclonal Antibody [Clone ID: R08-3P-1]
Sign In for Pricing
View Details ![PerCP/Cyanine5.5 Anti-Human CD11c Antibody[BU15]](https://cdn.genprice.uk/products/763/68dd14ab061270361e7d2c24/imageurl/e-ab-f1118j.webp)
E-AB-F1118J-01 20 Tests
PerCP/Cyanine5.5 Anti-Human CD11c Antibody[BU15]
Sign In for Pricing
View Details E-AB-F1118J-02 100 Tests
PerCP/Cyanine5.5 Anti-Human CD11c Antibody[BU15]
Sign In for Pricing
View Details