Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DCAF12L2 Peptide - C-terminal region

DCAF12L2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

WDR40C

UniProt

Q5VW00

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DCAF12L2 Rabbit Polyclonal Antibody (orb326751) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001013650

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LDPRQRQQNIRPLCSREGGTGVRSLSFYQHIITVGTGHGSLLFYDIRAQK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(±)-Perillaldehyde
TRC-P229700-5G 5 g

(±)-Perillaldehyde

Sign In for Pricing
View Details
CL2A Rabbit Monoclonal Antibody [Clone ID: 1G9]
TA421198S 10 µg

CL2A Rabbit Monoclonal Antibody [Clone ID: 1G9]

Sign In for Pricing
View Details
PXDN (NM_012293) Human Recombinant Protein
TP324518L 1 mg

PXDN (NM_012293) Human Recombinant Protein

Sign In for Pricing
View Details
RAD51D Rabbit Polyclonal Antibody
AP01250PU-N 100 µg

RAD51D Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant UBE2I Antibody
RC-5961-01 50 μL

Recombinant UBE2I Antibody

Sign In for Pricing
View Details
Recombinant UBE2I Antibody
RC-5961-02 100 µL

Recombinant UBE2I Antibody

Sign In for Pricing
View Details