Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC34 Peptide - C-terminal region

CCDC34 Peptide - C-terminal region

Product Specifications

Product Name Alternative

NY-REN-41, RAMA3

UniProt

Q96HJ3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCDC34 Rabbit Polyclonal Antibody (orb587180) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_542385

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IGKEKEERDRLQLKALEELNQQLEKRKEMEEREKRKIIAEEKHKEWVQKK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

H47 sgRNA CRISPR Lentivector set (Mouse)
K4016501 3x 1.0 µg

H47 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Ythdf3 ORF Vector (Mouse) (pORF)
50640014 1.0 µg DNA

Ythdf3 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Mouse p-TAU181 ELISA Kit
E063745 1 Each

Mouse p-TAU181 ELISA Kit

Sign In for Pricing
View Details
Mouse Inhibin Beta E (INHbE) ELISA Kit
EKU04942 96 Tests

Mouse Inhibin Beta E (INHbE) ELISA Kit

Sign In for Pricing
View Details
Mouse Tcerg1 Pre-designed siRNA Set B
SI114366B 1 Each

Mouse Tcerg1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Interleukin 10 (IL10)
MBS2036241-01 0.1 mL

APC/CY7-Linked Polyclonal Antibody to Interleukin 10 (IL10)

Sign In for Pricing
View Details