Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC34 Peptide - C-terminal region

CCDC34 Peptide - C-terminal region

Product Specifications

Product Name Alternative

NY-REN-41, RAMA3

UniProt

Q96HJ3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCDC34 Rabbit Polyclonal Antibody (orb587180) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_542385

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IGKEKEERDRLQLKALEELNQQLEKRKEMEEREKRKIIAEEKHKEWVQKK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Ghrl/ Appetite-regulating hormone ELISA Kit
RK04429 96 Tests

Rat Ghrl/ Appetite-regulating hormone ELISA Kit

Sign In for Pricing
View Details
TRIM68 Rabbit Polyclonal Antibody
E10G23304 100 µL

TRIM68 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CRISPLD1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
16840066 1.0 µg DNA

CRISPLD1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Acetyl-Histone H4-K16 Rabbit pAb
E45R29228N 50 ul

Acetyl-Histone H4-K16 Rabbit pAb

Sign In for Pricing
View Details
Smad2 Recombinant Rabbit mAb
BS47820-01 50 µL

Smad2 Recombinant Rabbit mAb

Sign In for Pricing
View Details
Smad2 Recombinant Rabbit mAb
BS47820-02 100 µL

Smad2 Recombinant Rabbit mAb

Sign In for Pricing
View Details