Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC85C Peptide - C-terminal region

CCDC85C Peptide - C-terminal region

Product Specifications

UniProt

A6NKD9

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCDC85C Rabbit Polyclonal Antibody (orb327162) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001138467

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HAMKVLEVHENLDRQLQDSCEEDLSEKEKAIVREMCNVVWRKLGDAASSK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC680885 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV644739 1.0 µg DNA

LOC680885 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Dynlrb2 ORF Vector (Rat) (pORF)
18764016 1.0 µg DNA

Dynlrb2 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
PRTFDC1 antibody - N-terminal region (ARP48853_P050)
ARP48853_P050 100 µL

PRTFDC1 antibody - N-terminal region (ARP48853_P050)

Sign In for Pricing
View Details
Krev interaction trapped protein 1 (KRIT1) Human ELISA Kit
E5587 96 Tests

Krev interaction trapped protein 1 (KRIT1) Human ELISA Kit

Sign In for Pricing
View Details
HIS-Tag Mouse mAb
MBS8539587-01 0.1 mL

HIS-Tag Mouse mAb

Sign In for Pricing
View Details
HIS-Tag Mouse mAb
MBS8539587-02 0.1 mL (AF405L)

HIS-Tag Mouse mAb

Sign In for Pricing
View Details