Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRRC69 Peptide - C-terminal region

LRRC69 Peptide - C-terminal region

Product Specifications

UniProt

Q6ZNQ3

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LRRC69 Rabbit Polyclonal Antibody (orb587842) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001123362

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RYPQVRSMISQGKTCAICGQYFITVWLECVRFVPPPKDWKISKNLKLVPL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Akap12 Pre-designed siRNA Set A
SI100470A 1 Each

Mouse Akap12 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Recombinant Human ALKBH5
MBS7613075-01 0.05 mg

Recombinant Human ALKBH5

Sign In for Pricing
View Details
Recombinant Human ALKBH5
MBS7613075-02 0.2 mg

Recombinant Human ALKBH5

Sign In for Pricing
View Details
Recombinant Human ALKBH5
MBS7613075-03 1 mg

Recombinant Human ALKBH5

Sign In for Pricing
View Details
Recombinant Human ALKBH5
MBS7613075-04 5x 1 mg

Recombinant Human ALKBH5

Sign In for Pricing
View Details
5-Ethyl-1H-1,2,4-triazole-3-thiol
OR1046672-01 100 mg

5-Ethyl-1H-1,2,4-triazole-3-thiol

Sign In for Pricing
View Details