Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRRC69 Peptide - C-terminal region

LRRC69 Peptide - C-terminal region

Product Specifications

UniProt

Q6ZNQ3

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LRRC69 Rabbit Polyclonal Antibody (orb587842) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001123362

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RYPQVRSMISQGKTCAICGQYFITVWLECVRFVPPPKDWKISKNLKLVPL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

D4Ertd22e CRISPRa sgRNA lentivector (set of three targets)(Mouse)
17602124 3x 1.0µg DNA

D4Ertd22e CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
Mouse Anti-SARS-CoV-2 NP monoclonal antibody, clone NB2
CABT-MMB2 1 mg

Mouse Anti-SARS-CoV-2 NP monoclonal antibody, clone NB2

Sign In for Pricing
View Details
(1-Phenyl-1H-pyrazol-3-yl) boronic acid
OR1049377-01 100 mg

(1-Phenyl-1H-pyrazol-3-yl) boronic acid

Sign In for Pricing
View Details
(1-Phenyl-1H-pyrazol-3-yl) boronic acid
OR1049377-02 250 mg

(1-Phenyl-1H-pyrazol-3-yl) boronic acid

Sign In for Pricing
View Details
Anti-HOXA13 Polyclonal Antibody
TMAB-07240-01 50 μL

Anti-HOXA13 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-HOXA13 Polyclonal Antibody
TMAB-07240-02 100 µL

Anti-HOXA13 Polyclonal Antibody

Sign In for Pricing
View Details