Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRAMEF19 Peptide - N-terminal region

PRAMEF19 Peptide - N-terminal region

Product Specifications

UniProt

Q5SWL8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRAMEF19 Rabbit Polyclonal Antibody (orb327179) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EKQPLKVFMDVCLKEKSVDEDLSFFSGWVQHRRRSVHLCCTKVVNYSMNI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hamster Dorsal Root Ganglia Homeobox Protein (DRGX) ELISA Kit
MBS9388488-01 48 Well

Hamster Dorsal Root Ganglia Homeobox Protein (DRGX) ELISA Kit

Sign In for Pricing
View Details
Hamster Dorsal Root Ganglia Homeobox Protein (DRGX) ELISA Kit
MBS9388488-02 96 Well

Hamster Dorsal Root Ganglia Homeobox Protein (DRGX) ELISA Kit

Sign In for Pricing
View Details
Hamster Dorsal Root Ganglia Homeobox Protein (DRGX) ELISA Kit
MBS9388488-03 5x 96 Well

Hamster Dorsal Root Ganglia Homeobox Protein (DRGX) ELISA Kit

Sign In for Pricing
View Details
Hamster Dorsal Root Ganglia Homeobox Protein (DRGX) ELISA Kit
MBS9388488-04 10x 96 Well

Hamster Dorsal Root Ganglia Homeobox Protein (DRGX) ELISA Kit

Sign In for Pricing
View Details
CD40 Antibody
GWB-C901FE 0.025 mg

CD40 Antibody

Sign In for Pricing
View Details
PIGQ (cDNA, FLJ95129, Highly Similar to Homo Sapiens Phosphatidylinositol Glycan, Class Q (PIGQ), Transcript Variant 2, mRNA EMBL BAG36993.1, Phosphatidylinositol Glycan Anchor Biosynthesis, Class Q)
488657 100 µL

PIGQ (cDNA, FLJ95129, Highly Similar to Homo Sapiens Phosphatidylinositol Glycan, Class Q (PIGQ), Transcript Variant 2, mRNA EMBL BAG36993.1, Phosphatidylinositol Glycan Anchor Biosynthesis, Class Q)

Sign In for Pricing
View Details