Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRAMEF19 Peptide - N-terminal region

PRAMEF19 Peptide - N-terminal region

Product Specifications

UniProt

Q5SWL8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRAMEF19 Rabbit Polyclonal Antibody (orb327179) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EKQPLKVFMDVCLKEKSVDEDLSFFSGWVQHRRRSVHLCCTKVVNYSMNI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Neuritin Antibody [mFluor Violet 610 SE]
NBP1-77282MFV610 0.1 mL

Rabbit Polyclonal Neuritin Antibody [mFluor Violet 610 SE]

Sign In for Pricing
View Details
TRMT5 Protein Vector (Mouse) (pPB-C-His)
PV241846 500 ng

TRMT5 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
FAM83B antibody
70R-3283 100 µL

FAM83B antibody

Sign In for Pricing
View Details
CREB (Ser133) Polyclonal Antibody
ABP-PAB-21005 100 ug

CREB (Ser133) Polyclonal Antibody

Sign In for Pricing
View Details
Amredobresib (BI894999) 50mg
A24389-50 50 mg

Amredobresib (BI894999) 50mg

Sign In for Pricing
View Details
1110008F13Rik (NM_026124) Mouse Tagged Lenti ORF Clone
MR200715L4 10 µg

1110008F13Rik (NM_026124) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details