Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UPK3BL1 Peptide - C-terminal region

UPK3BL1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

UPLP, UPK3BL

UniProt

B0FP48

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UPK3BL1 Rabbit Polyclonal Antibody (orb327183) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001107875

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PTKIGCNHPLPGPGPYRVKFLVMNDEGPVAETKWSSDTRLQQAQALRAVP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD95 (B-R18), CF405S conjugate, 0.1mg/mL
BNC040305-100 1x 100 µL

CD95 (B-R18), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), CF405S conjugate, 0.1mg/mL
BNC040096-100 1x 100 µL

Histone H1 (AE-4), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (136-4B5), CF740 conjugate, 0.1mg/mL
BNC740173-100 1x 100 µL

CD45 / LCA (136-4B5), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (WA-1), 0.2mg/mL
BNUB0043-500 1x 500 µL

P21 / WAF1 (WA-1), 0.2mg/mL

Sign In for Pricing
View Details
Human Kappa Light Chain (Kap-56), CF740 conjugate, 0.1mg/mL
BNC740859-100 1x 100 µL

Human Kappa Light Chain (Kap-56), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), CF640R conjugate, 0.1mg/mL
BNC400871-500 1x 500 µL

CD71 (66IG10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details