Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAPK3 Peptide - N-terminal region

MAPK3 Peptide - N-terminal region

Product Specifications

UniProt

P27361

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MAPK3 Rabbit Polyclonal Antibody (orb587891) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GGGGGEPRRTEGVGPGVPGEVEMVKGQPFDVGPRYTQLQYIGEGAYGMVS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IKK gamma Recombinant Rabbit Monoclonal Antibody (APC-Cy7)
orb2350164 100 µL

IKK gamma Recombinant Rabbit Monoclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details
Recombinant Shigella Flexneri pdxY Protein (aa 1-287)
VAng-Lsx08014-500gEcoli 500 µg (E. coli)

Recombinant Shigella Flexneri pdxY Protein (aa 1-287)

Sign In for Pricing
View Details
Cdr2 ORF Vector (Rat) (pORF)
15746016 1.0 µg DNA

Cdr2 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Mouse CYPA (Cyclophilin A) ELISA Kit
E-EL-M0384-01 24 Tests

Mouse CYPA (Cyclophilin A) ELISA Kit

Sign In for Pricing
View Details
Mouse CYPA (Cyclophilin A) ELISA Kit
E-EL-M0384-02 48 Tests

Mouse CYPA (Cyclophilin A) ELISA Kit

Sign In for Pricing
View Details
Mouse CYPA (Cyclophilin A) ELISA Kit
E-EL-M0384-03 96 Tests

Mouse CYPA (Cyclophilin A) ELISA Kit

Sign In for Pricing
View Details