Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SFI1 Peptide - C-terminal region

SFI1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

PISD, hSfi1p

UniProt

A8K8P3

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SFI1 Rabbit Polyclonal Antibody (orb327192) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055590

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LELNTAHSARKQPRRPHFLLEPAQSQRPQKPQEHGLGMAQPAAPSLTRPF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HAO1 Mouse Monoclonal Antibody [Clone ID: OTI5A1]
CF501959 100 µg

HAO1 Mouse Monoclonal Antibody [Clone ID: OTI5A1]

Sign In for Pricing
View Details
FOXO1a (FKH1, FKHR, FOXO1, Forkhead Box O1a, Forkhead Homolog1, Forkhead Rhabdomysarcoma) (APC)
F9049-02D-APC 100 µL

FOXO1a (FKH1, FKHR, FOXO1, Forkhead Box O1a, Forkhead Homolog1, Forkhead Rhabdomysarcoma) (APC)

Sign In for Pricing
View Details
Rat Pro-Cathepsin H (CTSH) Protein
abx658686-01 10 µg

Rat Pro-Cathepsin H (CTSH) Protein

Sign In for Pricing
View Details
Rat Pro-Cathepsin H (CTSH) Protein
abx658686-02 50 µg

Rat Pro-Cathepsin H (CTSH) Protein

Sign In for Pricing
View Details
Rat Pro-Cathepsin H (CTSH) Protein
abx658686-03 100 µg

Rat Pro-Cathepsin H (CTSH) Protein

Sign In for Pricing
View Details
Rat Pro-Cathepsin H (CTSH) Protein
abx658686-04 200 µg

Rat Pro-Cathepsin H (CTSH) Protein

Sign In for Pricing
View Details