SFI1 Peptide - C-terminal region
SFI1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
PISD, hSfi1p
UniProt
A8K8P3
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SFI1 Rabbit Polyclonal Antibody (orb327192) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_055590
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LELNTAHSARKQPRRPHFLLEPAQSQRPQKPQEHGLGMAQPAAPSLTRPF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K1506208 1.0 µg DNA
OR4C15 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
Sign In for Pricing
View Details 
MBS6396523-01 0.1 mL
TICAM2 (TIRAP3, TIRP, TRAM, TIR Domain-containing Adapter Molecule 2, Putative NF-kappa-B-activating Protein 502, TRIF-related Adapter Molecule, Toll-like Receptor Adaptor Protein 3, Toll/Interleukin-1 Receptor Domain-containing Protein, MGC129876, MGC129
Sign In for Pricing
View Details MBS6396523-02 5x 0.1 mL
TICAM2 (TIRAP3, TIRP, TRAM, TIR Domain-containing Adapter Molecule 2, Putative NF-kappa-B-activating Protein 502, TRIF-related Adapter Molecule, Toll-like Receptor Adaptor Protein 3, Toll/Interleukin-1 Receptor Domain-containing Protein, MGC129876, MGC129
Sign In for Pricing
View Details 